Loading...
Statistics
Advertisement

Landcentre.net

Advertisement
Conversion Technology Metas Server
Landcentre.net is hosted in Canada / Markham . Landcentre.net uses HTTPS protocol. Number of used technologies: 5. First technologies: AJAX Libraries API, CSS, Html, Number of used javascripts: 3. First javascripts: Jquery.min.js, Bootstrap.min.js, Api.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4.

Technologies in use by Landcentre.net

Technology

Number of occurences: 5
  • AJAX Libraries API
  • CSS
  • Html
  • Iframe
  • jQuery

Advertisement

Javascripts

Number of occurences: 3
  • jquery.min.js
  • bootstrap.min.js
  • api.js

Server Type

  • Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Landcentre.net

SSL certificate

    • name: /CN=main.smartunits.com/emailAddress=ssl@main.smartunits.com
    • subject:
      • CN: main.smartunits.com
      • emailAddress: ssl@main.smartunits.com
    • hash: c0470ad9
    • issuer:
      • CN: main.smartunits.com
      • emailAddress: ssl@main.smartunits.com
    • version: 2
    • serialNumber: 4847013349
    • validFrom: 160117055408Z
    • validTo: 170116055408Z
    • validFrom_time_t: 1453010048
    • validTo_time_t: 1484546048
    • extensions:
      • subjectKeyIdentifier: 3F:8B:64:45:2A:22:93:2D:22:72:22:2F:4D:E1:8B:1F:17:52:D4:68
      • authorityKeyIdentifier: keyid:3F:8B:64:45:2A:22:93:2D:22:72:22:2F:4D:E1:8B:1F:17:52:D4:68
      • basicConstraints: CA:FALSE

Meta - Landcentre.net

Number of occurences: 3
  • Name:
    Content: IE=edge
  • Name: description
    Content:
  • Name: viewport
    Content: width=device-width, initial-scale=1

Server / Hosting

  • IP: 158.85.92.5
  • Latitude: 43.88
  • Longitude: -79.26
  • Country: Canada
  • City: Markham

Rname

  • ns1.smartunits.com
  • ns2.smartunits.com
  • landcentre.net

Target

  • internal.tangle.ca

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sat, 30 Jul 2016 07:44:48 GMT Server: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 Location: http://landcentre.net/ Vary: Accept-Encoding Content-Length: 230 Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 OK Date: Sat, 30 Jul 2016 07:44:48 GMT Server: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=cc2598bc477ca8828636caaaf2f99b4d; path=/ X-UA-Compatible: IE=edge X-Content-Type-Options: nosniff Access-Control-Allow-Origin: * Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Transfer-Encoding: chunked Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

DNS

host: landcentre.net
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 158.85.92.5
host: landcentre.net
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.smartunits.com
host: landcentre.net
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.smartunits.com
host: landcentre.net
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.smartunits.com
  5. rname: internal.tangle.ca
  6. serial: 2016060601
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: landcentre.net
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: landcentre.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.andcentre.net, www.luandcentre.net, www.uandcentre.net, www.l8andcentre.net, www.8andcentre.net, www.l9andcentre.net, www.9andcentre.net, www.ljandcentre.net, www.jandcentre.net, www.l0andcentre.net, www.0andcentre.net, www.lmandcentre.net, www.mandcentre.net, www.lpandcentre.net, www.pandcentre.net, www.loandcentre.net, www.oandcentre.net, www.lndcentre.net, www.laondcentre.net, www.londcentre.net, www.lapndcentre.net, www.lpndcentre.net, www.la9ndcentre.net, www.l9ndcentre.net, www.landcentre.net, www.lndcentre.net, www.laindcentre.net, www.lindcentre.net, www.laundcentre.net, www.lundcentre.net, www.ladcentre.net, www.lanndcentre.net, www.landcentre.net, www.lanhdcentre.net, www.lahdcentre.net, www.lanjdcentre.net, www.lajdcentre.net, www.lankdcentre.net, www.lakdcentre.net, www.lanldcentre.net, www.laldcentre.net, www.lan dcentre.net, www.la dcentre.net, www.lancentre.net, www.landtcentre.net, www.lantcentre.net, www.landgcentre.net, www.langcentre.net, www.landbcentre.net, www.lanbcentre.net, www.landxcentre.net, www.lanxcentre.net, www.landscentre.net, www.lanscentre.net, www.landfcentre.net, www.lanfcentre.net, www.landvcentre.net, www.lanvcentre.net, www.landycentre.net, www.lanycentre.net, www.landzcentre.net, www.lanzcentre.net, www.landacentre.net, www.lanacentre.net, www.landecentre.net, www.lanecentre.net, www.landrcentre.net, www.lanrcentre.net, www.landentre.net, www.landcdentre.net, www.landdentre.net, www.landcrentre.net, www.landrentre.net, www.landctentre.net, www.landtentre.net, www.landcventre.net, www.landventre.net, www.landcfentre.net, www.landfentre.net, www.landcgentre.net, www.landgentre.net, www.landchentre.net, www.landhentre.net, www.landcnentre.net, www.landnentre.net, www.landcmentre.net, www.landmentre.net, www.landcjentre.net, www.landjentre.net, www.landcntre.net, www.landcexntre.net, www.landcxntre.net, www.landcesntre.net, www.landcsntre.net, www.landcewntre.net, www.landcwntre.net, www.landcerntre.net, www.landcrntre.net, www.landcefntre.net, www.landcfntre.net, www.landcevntre.net, www.landcvntre.net, www.landcecntre.net, www.landccntre.net, www.landceqntre.net, www.landcqntre.net, www.landceantre.net, www.landcantre.net, www.landceyntre.net, www.landcyntre.net, www.landcetre.net, www.landcenntre.net, www.landcentre.net, www.landcenhtre.net, www.landcehtre.net, www.landcenjtre.net, www.landcejtre.net, www.landcenktre.net, www.landcektre.net, www.landcenltre.net, www.landceltre.net, www.landcen tre.net, www.landce tre.net, www.landcenre.net, www.landcentqre.net, www.landcenqre.net, www.landcentare.net, www.landcenare.net, www.landcent re.net, www.landcen re.net, www.landcentwre.net, www.landcenwre.net, www.landcentere.net, www.landcenere.net, www.landcentzre.net, www.landcenzre.net, www.landcentxre.net, www.landcenxre.net, www.landcentcre.net, www.landcencre.net, www.landcente.net, www.landcentrie.net, www.landcentie.net, www.landcentroe.net, www.landcentoe.net, www.landcentrle.net, www.landcentle.net, www.landcentrle.net, www.landcentle.net, www.landcentr.e.net, www.landcent.e.net, www.landcentr.net, www.landcentrex.net, www.landcentrx.net, www.landcentres.net, www.landcentrs.net, www.landcentrew.net, www.landcentrw.net, www.landcentrer.net, www.landcentrr.net, www.landcentref.net, www.landcentrf.net, www.landcentrev.net, www.landcentrv.net, www.landcentrec.net, www.landcentrc.net, www.landcentreq.net, www.landcentrq.net, www.landcentrea.net, www.landcentra.net, www.landcentrey.net, www.landcentry.net,

Other websites we recently analyzed

  1. flying-toasters.com - Diese Website steht zum Verkauf! - Informationen zum Thema flying-toasters.
    Diese
    Cambridge (United States) - 72.52.4.90
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 3
    Number of meta tags: 5
  2. Home - Precious Paws and Claws
    Precious Paws and Claws is a small family pet crematory secializing in private pet cremation.
    Wayne (United States) - 74.208.253.220
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  3. Lodge Justitia No.82
    India - 103.14.121.95
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 1
    Number of meta tags: 1
  4. readmansions.co.uk
    Gloucester (United Kingdom) - 88.208.252.9
    Server software: Microsoft-IIS/7.0
    Technology: Html
    Number of meta tags: 2
  5. Reload.LK - Reload/Recharge Prepaid Mobiles Online
    Kiel (Germany) - 83.125.22.184
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery, Php, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 1
  6. insurancecomments.com
    Houston (United States) - 192.185.29.249
    Server software: nginx/1.10.0
    Technology: Html
    Number of meta tags: 2
  7. hg57777.com
    hg57777.com
    Las Vegas (United States) - 70.39.84.241
    Server software:
    Technology: CSS, jQuery
    Number of Javascript: 1
    Number of meta tags: 4
  8. William & Brandi sittin' in a tree..
    William & Brandi's Wedding - August 21st Gale Woods Farm
    Culver City (United States) - 205.186.183.161
    Server software: Apache/2.2.22
    Technology: CSS, Google Font API, Html, Iframe, Javascript, Google Analytics, Wordpress
    Number of Javascript: 4
    Number of meta tags: 4
  9. Portail SCPI OPCI : Conseils d’experts pour investir
    Primaliance, le 1er portail dédié aux SCPI de rendement, SCPI fiscales et aux OPCI : toute l’information, les offres et les conseils pour bien investir.
    France - 46.105.42.212
    Server software: Apache/2.2.16 (Debian)
    Technology: DoubleClick.Net, CSS, Fancybox, Font Awesome, Google Font API, Html, Javascript, jQuery Cookie, jQuery Cycle, jQuery Fancybox, Google Analytics, Google AdWords Conversion Tracking, Google Remarketing, Facebook Box, Google +1 Button
    Number of Javascript: 19
    Number of meta tags: 6
  10. familievakantiekleinwalsertal.nl - Home
    Appartement in het Kleinwalsertal. Leuk appartement te huur in het Aparthotel in Kleinwalsertal. Beleef een heerlijke vakantie met het hele gezin. Winter of zomer, er is altijd wat te doen.
    Netherlands - 93.94.226.163
    Server software: Apache
    Technology: CSS, Html, Php
    Number of meta tags: 4

Check Other Websites